Use Able AI chat for product recommendations

SLC32A1/VGAT Polyclonal antibody

SLC32A1/VGAT Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, ELISA

Cat No. 14471-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, IF-Fro, IP, ELISA

SLC32A1, VGAT, GABA and glycine transporter, hVIAAT, Vesicular GABA transporter

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inunboiled mouse brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inrat brain tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue, mouse brain tissue
Positive IF-Fro detected inrat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14471-1-AP targets SLC32A1/VGAT in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, caenorhabditis elegans
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5843

Product name: Recombinant human SLC32A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-124 aa of BC053582

Sequence: MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWEAGWN

Predict reactive species
Full Name solute carrier family 32 (GABA vesicular transporter), member 1
Calculated Molecular Weight 57 kDa
Observed Molecular Weight 57 kDa
GenBank Accession NumberBC053582
Gene Symbol VGAT
Gene ID (NCBI) 140679
RRIDAB_10644324
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H598
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC32A1, also known as VGAT (vesicular GABA transporter), functions in the uptake of GABA and glycine into synaptic vesicles. GABA (gamma-aminobutyric acid), is the major inhibitory neurotransmitter in the CNS. VGAT transports GABA and glycine into acidic vesicles and localizes to the synaptic vesicle in glycinergic and GABAergic neurons. And VGAT antibodies are useful markers for presynaptic GABAergic and glycinergic neurons.

Protocols

Product Specific Protocols
IF protocol for SLC32A1/VGAT antibody 14471-1-APDownload protocol
IHC protocol for SLC32A1/VGAT antibody 14471-1-APDownload protocol
IP protocol for SLC32A1/VGAT antibody 14471-1-APDownload protocol
WB protocol for SLC32A1/VGAT antibody 14471-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Acta Neuropathol Commun

Mutation-induced loss of APP function causes GABAergic depletion in recessive familial Alzheimer's disease: analysis of Osaka mutation-knockin mice.

Authors - Tomohiro Umeda
humanWB

Biochem J

Role of N-glycosylation in renal betaine transport.

Authors - Eva S Schweikhard
mouseWB

Biol Trace Elem Res

Effect of Voluntary Wheel Running on Anxiety- and Depression-Like Behaviors in Fluoride-Exposed Mice

Authors - Mengjie Qi
Caenorhabditis elegansIHC,IF

PLoS One

Mutant TDP-43 and FUS cause age-dependent paralysis and neurodegeneration in C. elegans.

Authors - Vaccaro Alexandra A
humanIF

Curr Issues Mol Biol

miR-92a-2-5p Regulates the Proliferation and Differentiation of ASD-Derived Neural Progenitor Cells.

Authors - Wenting Zhuang
mouseWB

Biol Trace Elem Res

Exercise Ameliorates Fluoride-induced Anxiety- and Depression-like Behavior in Mice: Role of GABA.

Authors - Qiqi Cao

Reviews

    3.3 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Reyes (Verified Customer) (03-04-2024)

vGAT worked on my human brain FFPE sections although the quantification would be difficult due to the high autofluorescence

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
SLC32A1/VGAT Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:14471-1-AP)

Mandi (Verified Customer) (03-10-2020)

Did not stain the nerve terminals well. Signal was localized to the soma mainly.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: human cortical neurons

Ute (Verified Customer) (03-03-2020)

blocking solution 5% skimmed milk in 1x TBS-T

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: mouse hippocampal lysat
Loading...
||
New chat

Able

正在加载,请稍候...