SLC35A5 Polyclonal antibody

• 

  WB analysis using 33755-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33755-1-AP (SLC35A5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

SLC35A5 Polyclonal Antibody for WB, ELISA

Cat No. 33755-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Solute carrier family 35 member A5, UDP-sugar transporter protein SLC35A5, UNQ164/PRO190

---

Tested Applications

• Positive WB detected in: DU 145 cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33755-1-AP targets SLC35A5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8748

  Product name: Recombinant human SLC35A5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 171-424 aa of BC005207

  Sequence: LQHNLAGRGFHHDAFFSPSNSCLLFRSECPRKDNCTAKEWTFPEAKWNTTARVFSHIRLGMGHVLIIVQCFISSMAIIYNEKILKEGNQLTESIFIQNSKLYFFGILFNGLTLGLQRSNRDQIKNCGFFYGHSAFSVALIFVTAFQGLSVAFILKFLDNMFHVLMAQVTTVIITTVSVLVFDFRPSLEFFLEAPSVLLSIFIYNASKPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDTF

• Full Name: solute carrier family 35, member A5
• Calculated Molecular Weight: 424 aa, 49 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC005207
• Gene Symbol: SLC35A5
• Gene ID (NCBI): 55032
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BS91
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Solute carrier family 35 member A5 (SLC35A5) is a member of the SLC35A protein subfamily comprising nucleotide sugar transporters. SLC35A5 is the sole member of the SLC35 family that contains several diacidic motifs within its cytosolically exposed C-terminus, some of which might be capable of UDP-sugar binding (PMID: 30641943).