SLC35D1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC35D1 Polyclonal antibody, PBS Only (31019-1-PBS)

• 

  WB analysis using 31019-1-AP (same clone as 31019-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31019-1-AP (SLC35D1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31019-1-PBS in a different storage buffer formulation.

SLC35D1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31019-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Solute carrier family 35 member D1, Nucleotide sugar transporter SLC35D1

---

Product Information

31019-1-PBS targets SLC35D1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34372

  Product name: Recombinant human SLC35D1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 89-157 aa of BC093786

  Sequence: VGKALRVVKFPDLDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFTMFAEGVLLKKT

• Full Name: solute carrier family 35 (UDP-glucuronic acid/UDP-N-acetylgalactosamine dual transporter), member D1
• Calculated Molecular Weight: 355 aa, 39 kDa
• Observed Molecular Weight: 35-39 kDa
• GenBank Accession Number: BC093786
• Gene Symbol: SLC35D1
• Gene ID (NCBI): 23169
• RRID: AB_3669816
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NTN3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC35D1 belongs to the TPT transporter family and is a nucleotide sugar transporter (NST) expressed in the endoplasmic reticulum. Loss-of-function mutations in SLC35D1 cause Schneckenbecken dysplasia, a severe skeletal dysplasia (PMID: 19508970; 35934917).