SLC35E2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC35E2B Polyclonal antibody, PBS Only (17829-1-PBS)

• 

  WB analysis using 17829-1-AP (same clone as 17829-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17829-1-AP (SLC35E2B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17829-1-PBS in a different storage buffer formulation.

SLC35E2B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17829-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17829-1-PBS targets SLC35E2B in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12211

  Product name: Recombinant human RP11-345P4.4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-82 aa of BC092507

  Sequence: MSSSVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENVLTVTITETTVIESDLGVWSSRALLYLTLW

• Full Name: similar to solute carrier family 35, member E2
• Calculated Molecular Weight: 236 aa, 43 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC092507
• Gene Symbol: SLC35E2B
• Gene ID (NCBI): 728661
• RRID: AB_3085542
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0CK96
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC35E2B, also known as SLC35E2, encodes solute carrier family 35 member E2B, functioning as a putative transporter. SLC35E2B is expressed in the heart, retina, skin, testis, and kidney (PMID:33711669).