SLC35F4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC35F4 Polyclonal antibody, PBS Only (32258-1-PBS)

• 

  WB analysis using 32258-1-AP (same clone as 32258-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32258-1-AP (SLC35F4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32258-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 32258-1-AP (same clone as 32258-1-PBS)

  WB result of SLC35F4 antibody (32258-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC35F4 transfected A431 cells. This data was developed using the same antibody clone with 32258-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLC35F4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32258-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C14orf36

---

Product Information

32258-1-PBS targets SLC35F4 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34518

  Product name: Recombinant human SLC35F4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 471-521 aa of NM_001206920

  Sequence: MLLPEEWDEITLRFINSLKEKKSEEHVDDVTDPSIHLRGRGRANGTVSIPLA

• Full Name: solute carrier family 35, member F4
• Calculated Molecular Weight: 521 aa, 58 kDa
• Observed Molecular Weight: 42 kDa, 65 kDa
• GenBank Accession Number: NM_001206920
• Gene Symbol: SLC35F4
• Gene ID (NCBI): 341880
• RRID: AB_3742555
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A4IF30
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.