SLC36A3 Monoclonal antibody, PBS Only

• 

  WB analysis of mouse testis using 67929-1-Ig (same clone as 67929-1-PBS)

  unboiled mouse testis tissue were subjected to SDS PAGE followed by western blot with 67929-1-Ig (SLC36A3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67929-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 67929-1-Ig (same clone as 67929-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 67929-1-Ig (SLC36A3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67929-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67929-1-Ig (same clone as 67929-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67929-1-Ig (SLC36A3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67929-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67929-1-Ig (same clone as 67929-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67929-1-Ig (SLC36A3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67929-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 67929-1-Ig (same clone as 67929-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using SLC36A3 antibody (67929-1-Ig, Clone: 1A8E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67929-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 67929-1-Ig (same clone as 67929-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using SLC36A3 antibody (67929-1-Ig, Clone: 1A8E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67929-1-PBS in a different storage buffer formulation.

SLC36A3 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67929-1-PBS

Clone No.1A8E6

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

FLJ16658, PAT3, SLC36A3, TRAMD2, Tramdorin 2, tramdorin2

---

Product Information

67929-1-PBS targets SLC36A3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16556

  Product name: Recombinant human SLC36A3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 84-190 aa of BC101092

  Sequence: VLTVHCMVILLNCAQHLSQRLQKTFVNYGEATMYGLETCPNTWLRAHAVWGRWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYRYTVSFLLVITQLGF

• Full Name: solute carrier family 36 (proton/amino acid symporter), member 3
• Calculated Molecular Weight: 511 aa, 56 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC101092
• Gene Symbol: SLC36A3
• Gene ID (NCBI): 285641
• RRID: AB_2918681
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q495N2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.