Tested Applications
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-68025 targets SLC39A3 in FC (Intra) applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14289 Product name: Recombinant human SLC39A3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 96-180 aa of BC005869 Sequence: FMTVFLEQLILTFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAH Predict reactive species |
| Full Name | solute carrier family 39 (zinc transporter), member 3 |
| Calculated Molecular Weight | 314 aa, 34 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC005869 |
| Gene Symbol | SLC39A3 |
| Gene ID (NCBI) | 29985 |
| RRID | AB_2923863 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9BRY0 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
SLC39A3, also named as ZIP3, belongs to the ZIP transporter (TC 2.A.5) family. SLC39A3 is a Zn importer that acts as a zinc-influx transporter. SLC39A3 is highly expressed in a cell-type-specific manner in ovaries, testes, and the developing nervous system with limited expression in the small intestinal crypt cells, kidney glomerulus, and discrete regions of the liver. SLC39A3 is also expressed in highly specialized, hormonally responsive secretory tissues, such as the pancreas, prostate, and mammary gland (PMID: 19458277). SLC39A3 has 2 isoforms with the molecular mass of 11 and 34 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 SLC39A3 antibody CL488-68025 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

