CoraLite® Plus 488-conjugated SLC39A3 Monoclonal antibody

SLC39A3 Monoclonal Antibody for FC (Intra)
Cat No. CL488-68025
Clone No.1A11F6

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

FC (Intra)

Zinc transporter ZIP3, ZIP 3, ZIP3, ZIP-3, Zrt and Irt like protein 3

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68025 targets SLC39A3 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14289

Product name: Recombinant human SLC39A3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 96-180 aa of BC005869

Sequence: FMTVFLEQLILTFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAH

Predict reactive species
Full Name solute carrier family 39 (zinc transporter), member 3
Calculated Molecular Weight 314 aa, 34 kDa
Observed Molecular Weight32 kDa
GenBank Accession NumberBC005869
Gene Symbol SLC39A3
Gene ID (NCBI) 29985
RRIDAB_2923863
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BRY0
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SLC39A3, also named as ZIP3, belongs to the ZIP transporter (TC 2.A.5) family. SLC39A3 is a Zn importer that acts as a zinc-influx transporter. SLC39A3 is highly expressed in a cell-type-specific manner in ovaries, testes, and the developing nervous system with limited expression in the small intestinal crypt cells, kidney glomerulus, and discrete regions of the liver. SLC39A3 is also expressed in highly specialized, hormonally responsive secretory tissues, such as the pancreas, prostate, and mammary gland (PMID: 19458277). SLC39A3 has 2 isoforms with the molecular mass of 11 and 34 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 SLC39A3 antibody CL488-68025Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...