SLC39A5 Polyclonal antibody

SLC39A5 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 17285-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

ZIP-5, ZIP5, ZIP 5, MYP24, LZT-Hs7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, mouse liver tissue, mouse pancreas tissue, rat kidney tissue, rat liver tissue, rat pancreas tissue
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

17285-1-AP targets SLC39A5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11067

Product name: Recombinant human SLC39A5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 23-215 aa of BC027884

Sequence: GSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQS

Predict reactive species
Full Name solute carrier family 39 (metal ion transporter), member 5
Calculated Molecular Weight 539 aa, 56 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC027884
Gene Symbol SLC39A5
Gene ID (NCBI) 283375
RRIDAB_2923566
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6ZMH5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC39A5 (Zip5) belongs to the ZIP family of metal ion transporters which function to transport zinc and/or other metal ion substrates from the extracellular space or organellar lumen into the cytoplasm. Most of ZIP members have eight predicted transmembrane domains and similar predicted topologies with the N- and C-termini of the protein located on the extracytoplasmic face of the membrane. Zip5 is a zinc uptake transporter that is specific for Zn(II) over other potential metal ion substrates. ZIP5 gene is most actively expressed in tissues involved in zinc homeostasis (intestine, visceral endoderm, pancreas) but is not induced during zinc deficiency. ZIP5 is localized to the basolateral surface of these cells under zinc-replete conditions but is internalized during periods of dietary zinc deficiency. These observations suggest that Zip5 plays a central role in controlling organismal zinc status. This antibody was generated against the N-terminal region of human SLC39A5 and is predicted to detect the endogenous level of SLC39A5 protein. The calculated molecular weight of SLC39A5 is 56 kDa. With glycosylation modification, the molecular weight of SLC39A5 will be migrated to 70 kDa.

Protocols

Product Specific Protocols
IHC protocol for SLC39A5 antibody 17285-1-APDownload protocol
WB protocol for SLC39A5 antibody 17285-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Animals (Basel)

Analysis of the Association of Two SNPs in the Promoter Regions of the PPP2R5C and SLC39A5 Genes with Litter Size in Yunshang Black Goats

Authors - Peng Wang
Loading...
||
New chat Able
正在加载,请稍候...