SLC44A5 Polyclonal antibody

• 

  IHC staining of human stomach using 21117-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 21117-1-AP (SLC44A5 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human stomach using 21117-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 21117-1-AP (SLC44A5 antibody) at dilution of 1:200 (under 40x lens).

SLC44A5 Polyclonal Antibody for IHC, ELISA

Cat No. 21117-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

CTL5, SLC44A5

---

Tested Applications

• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21117-1-AP targets SLC44A5 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15459

  Product name: Recombinant human SLC44A5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 42-211 aa of BC051740

  Sequence: TPNENKTILFYFNLLRCTSPSVLLNLQCPTTQICVSKCPEKFLTYVEMQLLYTKDKSYWEDYRQFCKTTAKPVKSLTQLLLDDDCPTAIFPSKPFLQRCFPDFSTKNGTLTIGSKMMFQDGNGGTRSVVELGIAANGINKLLDAKSLGLKVFEDYARTWYWILIGLTIAM

• Full Name: solute carrier family 44, member 5
• Calculated Molecular Weight: 719 aa, 82 kDa
• GenBank Accession Number: BC051740
• Gene Symbol: SLC44A5
• Gene ID (NCBI): 204962
• RRID: AB_3669360
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NCS7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The choline transport system has been categorized into three transporter families: Polyspecific organic cation transporters (OCTs/SLC22A1-2) with low affinity for choline, high-affinity choline transporter 1 (CHT1/SLC5A7) and intermediate-affinity choline transporter-like proteins (CTLs/SLC44A1-5). the CTLs/SLC44A1-5 were shown to be present in various human tissues. SLC44A5, also known as CTL5, is an integral membrane protein. SLC44A5 is involved in the membrane-spanning transport of choline.