SLC45A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC45A2 Polyclonal antibody (10453-1-AP)

SLC45A2 Polyclonal Antibody for IHC, ELISA

Cat No. 10453-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

1A1, AIM1, MATP, Melanoma antigen AIM1, Membrane-associated transporter protein

• 

  IHC staining of mouse colon using 10453-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10453-1-AP (SLC45A2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 10453-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 10453-1-AP (SLC45A2 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 10453-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 10453-1-AP (SLC45A2 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 10453-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10453-1-AP (SLC45A2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC45A2 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: mouse colon tissue, human malignant melanoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10453-1-AP targets SLC45A2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0699

  Product name: Recombinant human SLC45A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-159 aa of BC003597

  Sequence: MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFI

• Full Name: solute carrier family 45, member 2
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC003597
• Gene Symbol: SLC45A2
• Gene ID (NCBI): 51151
• RRID: AB_2191075
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UMX9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC45A2, also named as AIM1 and MATP, belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family. It is a melanocyte differentiation antigen. SLC45A2 may transport substances required for melanin biosynthesis. (PMID:17768386,21677667)Mutation of SLC45A2 cause oculocutaneous albinism type 4 (OCA4) which is disorder of pigmentation characterized by reduced biosynthesis of melanin in the skin, hair and eyes.

Publications

What published studies show

The anti-SLC45A2 antibody (Cat# 10453-1-AP) has 3 total citations published in Journal of Investigative Dermatology, Frontiers in Immunology, and Frontiers in Oncology. The research spans genetics of oculocutaneous albinism and neutropenia, cholesterol metabolism dysregulation in metastatic uveal melanoma, and prognostic biomarker identification in skin cutaneous melanoma. Applications include WB, IF, and IHC in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	J Invest Dermatol; Homozygosity mapping and whole-exome sequencing to detect SLC45A2 and G6PC3 mutations in a single patient with oculocutaneous albinism and neutropenia.; Authors - Cullinane Andrew R AR
human	WB	Front Immunol; Single-cell profiling deciphering cholesterol metabolism dysregulation in metastatic uveal melanoma and implicating SLC45A2 in its prognosis.; Authors - Yiming Zhou ; KD Validated
human	IHC	Front Oncol; New Prognostic Biomarkers and Drug Targets for Skin Cutaneous Melanoma via Comprehensive Bioinformatic Analysis and Validation.; Authors - Sitong Zhou