Prostein Monoclonal antibody

• 

  WB analysis using 60343-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60343-1-Ig (Prostein antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of JAR using 60343-1-Ig

  JAR cells were subjected to SDS PAGE followed by western blot with 60343-1-Ig (Prostein antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 60343-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 60343-1-Ig (Prostein antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 60343-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 60343-1-Ig (Prostein antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 60343-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60343-1-Ig (Prostein antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 60343-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60343-1-Ig (Prostein antibody at dilution of 1:200 (under 40x lens).

• 

  IF Staining of human prostate cancer using 60343-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human prostate cancer tissue using Prostein antibody (60343-1-Ig, Clone: 5E12E2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

Prostein Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 60343-1-Ig

Clone No.5E12E2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

SLC45A3, 5E12E2, PCANAP6, Prostate cancer-associated protein 6, PRST

---

Tested Applications

• Positive WB detected in: rat testis tissue, JAR cells, mouse testis tissue
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human prostate cancer tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60343-1-Ig targets Prostein in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5463

  Product name: Recombinant human SLC45A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 405-553 aa of BC050416

  Sequence: REKQVFLPKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEARVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQVVFDKSDLAKYSA

• Full Name: solute carrier family 45, member 3
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 55-59 kDa
• GenBank Accession Number: BC050416
• Gene Symbol: Prostein
• Gene ID (NCBI): 85414
• RRID: AB_2881452
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96JT2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prostein is a prostate tissue-specific protein whose expression is highly restricted to normal and cancerous prostate tissues. Anti-prostein is useful for the identification of prostate adenocarcinomas and is a good marker to identify prostatic origin in metastatic cancer.