SLC46A3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC46A3 Polyclonal antibody, PBS Only (31031-1-PBS)

• 

  IHC staining of mouse liver using 31031-1-AP (same clone as 31031-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31031-1-AP (SLC46A3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31031-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 31031-1-AP (same clone as 31031-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 31031-1-AP (SLC46A3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31031-1-PBS in a different storage buffer formulation.

SLC46A3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 31031-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

31031-1-PBS targets SLC46A3 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34359

  Product name: Recombinant human SLC46A3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-73 aa of BC060850

  Sequence: QYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQKKVSRFN

• Full Name: solute carrier family 46, member 3
• Calculated Molecular Weight: 463 aa, 52 kDa
• GenBank Accession Number: BC060850
• Gene Symbol: SLC46A3
• Gene ID (NCBI): 283537
• RRID: AB_3669822
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z3Q1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Solute carrier family 46 member 3 (SLC46A3) is a lysosomal membrane protein that belongs to the SLC46A family. SLC46A3 has been reported to be a proton-coupled, steroid conjugate, and bile acid transporter (PMID: 36741448). SLC46A3 plays an important role in Trastuzumab emtansine (T-DM1) treatment, a successful noncleavable antibody-drug conjugates (ADC) (PMID: 36741448).