SLC5A10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC5A10 Polyclonal antibody, PBS Only (17341-1-PBS)

• 

  WB analysis using 17341-1-AP (same clone as 17341-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 17341-1-AP (SLC5A10 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17341-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 17341-1-AP (same clone as 17341-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 17341-1-AP (SLC5A10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17341-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 17341-1-AP (same clone as 17341-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 17341-1-AP (SLC5A10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17341-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 17341-1-AP (same clone as 17341-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17341-1-AP (SLC5A10 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17341-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 17341-1-AP (same clone as 17341-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17341-1-AP (SLC5A10 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17341-1-PBS in a different storage buffer formulation.

SLC5A10 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17341-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

17341-1-PBS targets SLC5A10 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11378

  Product name: Recombinant human SLC5A10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 138-293 aa of BC039868

  Sequence: YGQLEAAYAQAIPSRTIANTTCHLPRTDAMHMFRDPHTGDLPWTGMTFGLTIMATWYWCTDQVIVQRSLSARDLNHAKAGSILASYLKMLPMGLIIMPGMISRALFPGAHVYEERHQVSVSRTDDVGCVVPSECLRACGAEVGCSNIAYPKLVMEL

• Full Name: solute carrier family 5 (sodium/glucose cotransporter), member 10
• Calculated Molecular Weight: 566 aa, 62 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC039868
• Gene Symbol: SLC5A10
• Gene ID (NCBI): 125206
• RRID: AB_2878390
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A0PJK1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.