Sodium iodide symporter Recombinant monoclonal antibody, PBS Only (Capture)

Sodium iodide symporter Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 84864-3-PBS
Clone No.242516E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

NIS, Natrium iodide transporter, SLC5A5, Sodium-iodide symporter (Na(+)/I(-) symporter)

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84864-3-PBS targets Sodium iodide symporter as part of a matched antibody pair:

MP01665-1: 84864-3-PBS capture and 84864-1-PBS detection (validated in Cytometric bead array)

MP01665-2: 84864-3-PBS capture and 84864-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag19504

Product name: Recombinant human SLC5A5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 538-643 aa of BC105047

Sequence: TVLCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL

Predict reactive species
Full Name solute carrier family 5 (sodium iodide symporter), member 5
Calculated Molecular Weight 643 aa, 69 kDa
GenBank Accession NumberBC105047
Gene Symbol Sodium iodide symporter
Gene ID (NCBI) 6528
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92911
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...