GAT1 Polyclonal antibody

• 

  WB analysis using 28488-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28488-1-AP (SLC6A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 28488-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 28488-1-AP (SLC6A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 28488-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 28488-1-AP (SLC6A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 28488-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28488-1-AP (SLC6A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 28488-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28488-1-AP (SLC6A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GAT1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 28488-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat and More (1)

Applications

WB, FC, IHC, ELISA

Synonyms

GABATHG, GABATR, GABT1, GAT 1, GAT1, SLC6A1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse cerebellum tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• FC: See 1 publications below

Product Information

28488-1-AP targets GAT1 in WB, FC, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29712

  Product name: Recombinant human SLC6A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-52 aa of BC033904

  Sequence: MATNGSKVADGQISTEVSEAPVANDKPKTLVVKVQKKAADLPDRDTWKGRFD

• Full Name: solute carrier family 6 (neurotransmitter transporter, GABA), member 1
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC033904
• Gene Symbol: GABA Transporter 1/GAT1
• Gene ID (NCBI): 6529
• RRID: AB_2881154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30531
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	FC	Aging Cell; Gamma frequency light flicker regulates amyloid precursor protein trafficking for reducing β-amyloid load in Alzheimer's disease model.; Authors - Qi Shen
mouse	WB	Neuropharmacology; A role of GABAA receptor α1 subunit in the hippocampus for rapid-acting antidepressant-like effects of ketamine; Authors - Xiao-Hui Tang
mouse	WB	Cell Biosci; Amelioration of olfactory dysfunction in a mouse model of Parkinson's disease via enhancing GABAergic signaling; Authors - Xing-Yang Liu
mouse	WB	J Exp Clin Cancer Res; GABA induced by sleep deprivation promotes the proliferation and migration of colon tumors through miR-223-3p endogenous pathway and exosome pathway; Authors - Haijun Bao