CoraLite® Plus 750-conjugated SLC6A12 Recombinant monoclonal antibody

• 

  WB analysis using CL750-83195-5

  Various lysates were subjected to SDS PAGE followed by western blot with CL750-83195-5 (SLC6A12 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

SLC6A12 Uni-rAb^® Recombinant Antibody for WB

Cat No. CL750-83195-5

Clone No.240021C10

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB

Synonyms

BGT 1, BGT1, FLJ38727, SLC6A12

---

Tested Applications

• Positive WB detected in: HepG2 cells, HuH-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL750-83195-5 targets SLC6A12 in WB applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18778

  Product name: Recombinant human SLC6A12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 548-614 aa of BC126215

  Sequence: VCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL

• Full Name: solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12
• Calculated Molecular Weight: 614 aa, 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC126215
• Gene Symbol: SLC6A12
• Gene ID (NCBI): 6539
• RRID: AB_3673777
• Conjugate: CoraLite® Plus 750 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 755 nm / 780 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48065
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.