SLC6A14 Polyclonal antibody

• 

  IHC staining of mouse lung using 18388-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 18388-1-AP (SLC6A14 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 18388-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 18388-1-AP (SLC6A14 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse lung using 18388-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using SLC6A14 antibody (18388-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SLC6A14 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 18388-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, ELISA

Synonyms

Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+), BMIQ11, ATB(0+), Amino acid transporter ATB0+

---

Tested Applications

• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse lung tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

18388-1-AP targets SLC6A14 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12857

  Product name: Recombinant human SLC6A14 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 138-264 aa of BC093710

  Sequence: YSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGVIVWYLALCLLLAWLIVGAALFKGIKSSGKV

• Full Name: solute carrier family 6 (amino acid transporter), member 14
• Calculated Molecular Weight: 642 aa, 72 kDa
• GenBank Accession Number: BC093710
• Gene Symbol: SLC6A14
• Gene ID (NCBI): 11254
• RRID: AB_3085563
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UN76
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) (SLC6A14) is a member of the Na+- and Cl−-dependent neurotransmitter transporter family and transports both neutral and cationic amino acids in an Na+- and Cl−-dependent manner.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Inflamm Res; α-Methyl-Tryptophan Inhibits SLC6A14 Expression and Exhibits Immunomodulatory Effects in Crohn's Disease; Authors - YongCheng Su