Tested Applications
| Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18388-1-AP targets SLC6A14 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12857 Product name: Recombinant human SLC6A14 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 138-264 aa of BC093710 Sequence: YSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGVIVWYLALCLLLAWLIVGAALFKGIKSSGKV Predict reactive species |
| Full Name | solute carrier family 6 (amino acid transporter), member 14 |
| Calculated Molecular Weight | 642 aa, 72 kDa |
| GenBank Accession Number | BC093710 |
| Gene Symbol | SLC6A14 |
| Gene ID (NCBI) | 11254 |
| RRID | AB_3085563 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UN76 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) (SLC6A14) is a member of the Na+- and Cl−-dependent neurotransmitter transporter family and transports both neutral and cationic amino acids in an Na+- and Cl−-dependent manner.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SLC6A14 antibody 18388-1-AP | Download protocol |
| IHC protocol for SLC6A14 antibody 18388-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Inflamm Res α-Methyl-Tryptophan Inhibits SLC6A14 Expression and Exhibits Immunomodulatory Effects in Crohn's Disease | ||
Funct Integr Genomics Bronchial epithelial-derived exosomal SLC6A14 promotes airway inflammation and mucus hypersecretion via the ZFP36L1/IL-8 axis. |





