SLC6A20 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLC6A20 Polyclonal antibody, PBS Only (30843-1-PBS)

• 

  WB analysis using 30843-1-AP (same clone as 30843-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30843-1-AP (SLC6A20 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30843-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 30843-1-AP (same clone as 30843-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using SLC6A20 antibody (30843-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30843-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 30843-1-AP (same clone as 30843-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using SLC6A20 antibody (30843-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30843-1-PBS in a different storage buffer formulation.

SLC6A20 Polyclonal Antibody for WB, IF-P, Indirect ELISA

Cat No. 30843-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Synonyms

SIT1, Sodium- and chloride-dependent transporter XTRP3, Sodium/imino-acid transporter 1, XT3, XTRP3

---

Product Information

30843-1-PBS targets SLC6A20 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33967

  Product name: Recombinant human SLC6A20 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 298-389 aa of BC136431

  Sequence: YGFKATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQGTGLAFIVYTEAIKNMEVSQ

• Full Name: solute carrier family 6 (proline IMINO transporter), member 20
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC136431
• Gene Symbol: SLC6A20
• Gene ID (NCBI): 54716
• RRID: AB_3669764
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NP91
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC6A20 also known as XT3, SIT1, belongs to the family of solute carrier 6, mediating the transport of neutral amino acids from the extracellular milieu toward cell or storage vesicles utilizing an electric membrane potential as the driving force. SLC6A20 is expressed in the kidney and small intestine and is localized in the brush marginal membrane of the proximal renal tubules (PMID: 16174864). Mutations in SLC6A20 are associated with Hyperglycinuria and Iminoglycinuria (PMID: 19033659)