Product Information
87227-1-PBS targets SLC6A20 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag33967 Product name: Recombinant human SLC6A20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 298-389 aa of BC136431 Sequence: YGFKATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQGTGLAFIVYTEAIKNMEVSQ Predict reactive species |
| Full Name | solute carrier family 6 (proline IMINO transporter), member 20 |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC136431 |
| Gene Symbol | SLC6A20 |
| Gene ID (NCBI) | 54716 |
| RRID | AB_3745416 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NP91 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC6A20 also known as XT3, SIT1, belongs to the family of solute carrier 6, mediating the transport of neutral amino acids from the extracellular milieu toward cell or storage vesicles utilizing an electric membrane potential as the driving force. SLC6A20 is expressed in the kidney and small intestine and is localized in the brush marginal membrane of the proximal renal tubules (PMID: 16174864). Mutations in SLC6A20 are associated with Hyperglycinuria and Iminoglycinuria (PMID: 19033659)



