SLC7A4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC7A4 Polyclonal antibody (15748-1-AP)

SLC7A4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15748-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

VH, HCAT3, CAT-4, CAT4, CAT 4

• 

  WB analysis of mouse brain using 15748-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15748-1-AP (SLC7A4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 15748-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 15748-1-AP (SLC7A4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15748-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15748-1-AP (SLC7A4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15748-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15748-1-AP (SLC7A4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15748-1-AP

  Immunofluorescent analysis of Hela cells, using SLC7A4 antibody 15748-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC7A4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human liver tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15748-1-AP targets SLC7A4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8211

  Product name: Recombinant human SLC7A4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 415-635 aa of BC008814

  Sequence: QKSSPPSSPGPASPGPLTKQQSSFSDHLQLVGTVHASVPEPGELKPALRPYLGFLDGYSPGAVVTWALGVMLASAITIGCVLVFGNSTLHLPHWGYILLLLLTSVMFLLSLLVLGAHQQQYREDLFQIPMVPLIPALSIVLNICLMLKLSYLTWVRFSIWLLMGLAVYFGYGIRHSKENQRELPGLNSTHYVVFPRGSLEETVQAMQPPSQAPAQDPGHME

• Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 4
• Calculated Molecular Weight: 635 aa, 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC008814
• Gene Symbol: SLC7A4
• Gene ID (NCBI): 6545
• RRID: AB_2190966
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43246
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SLC7A4 Polyclonal antibody (Cat# 15748-1-AP) has 1 total citation. It was cited in Frontiers in Cell and Developmental Biology (2021), in a study identifying metabolism subtypes of skin cutaneous melanoma associated with the tumor microenvironment and immunotherapy. The research field encompasses melanoma biology, tumor microenvironment characterization, metabolic subtyping, and immunotherapy response. The antibody was applied via IHC on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Front Cell Dev Biol; The Identification of the Metabolism Subtypes of Skin Cutaneous Melanoma Associated With the Tumor Microenvironment and the Immunotherapy.; Authors - Ronghua Yang