• Featured Product
  • KD/KO Validated

SLC7A5 Polyclonal antibody

SLC7A5 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 13752-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

D16S469E, CD98LC, CD98 light chain, 4F2LC, 4F2 light chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse lung tissue, human placenta tissue, MCF-7 cells
Positive IHC detected inhuman lung tissue, mouse lung tissue, mouse liver tissue, human testis tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13752-1-AP targets SLC7A5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, cow
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4694

Product name: Recombinant human SLC7A5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 300-507 aa of BC039692

Sequence: LSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQET

Predict reactive species
Full Name solute carrier family 7 (cationic amino acid transporter, y+ system), member 5
Calculated Molecular Weight 507 aa, 55 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC039692
Gene Symbol SLC7A5
Gene ID (NCBI) 8140
RRIDAB_2190973
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ01650
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Large neutral amino acid transporter 1 LAT1(also named as SLC7A5) is a sodium- and pH-independent transporter that supplies essential amino acids (e.g., leucine, phenylalanine) to cells. It plays an important role in the blood-brain barrier (BBB), where it facilitates the transport of thyroid hormones, drugs (e.g., l-DOPA, gabapentin), and metabolites to the brain. In addition, its expression is highly upregulated in various types of human cancers, which are characterized by a high demand for amino acids for growth and proliferation. The LAT1 subunit in humans is a 507 amino acid-long polypeptide with a theoretical molecular mass of 55 kDa. The protein is hydrophobic and is predicted to be constituted by 12 transmembrane segments. The apparent molecular mass of the proteins diminished to approximately 35 - 40 kDa.(PMID: 23912240 ;PMID: 26256001)

Protocols

Product Specific Protocols
IHC protocol for SLC7A5 antibody 13752-1-APDownload protocol
WB protocol for SLC7A5 antibody 13752-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Front Med

Targeting deubiquitinase OTUB1 protects vascular smooth muscle cells in atherosclerosis by modulating PDGFRβ

Authors - Fei Xu
humanWB

Cell Mol Life Sci

Regulation of branched-chain amino acid metabolism by hypoxia-inducible factor in glioblastoma.

Authors - Bo Zhang
humanIHC

J Nucl Med

PMID: 29700126

Authors - Deep Hathi
mouseWB

Mol Metab

Resistance exercise enhances long-term mTORC1 sensitivity to leucine

Authors - Gommaar D'Hulst
humanWB

ACS Chem Neurosci

Baicalein Delays H2O2-Induced Astrocytic Senescence through Inhibition of Senescence-Associated Secretory Phenotype (SASP), Suppression of JAK2/STAT1/NF-κB Pathway, and Regulation of Leucine Metabolism.

Authors - Li Gao
humanWB,IHC

J Biol Chem

GSE1 predicts poor survival outcome in gastric cancer patients by SLC7A5 enhancement of tumor growth and metastasis.

Authors - Keshuo Ding
Loading...
||
New chat Able
正在加载,请稍候...