SLC7A5 Monoclonal antibody

• 

  WB analysis using 67951-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67951-1-Ig (SLC7A5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

SLC7A5 Monoclonal Antibody for WB, ELISA

Cat No. 67951-1-Ig

Clone No.2G5H3

Publications(3)

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (1)

Applications

WB, IF, ELISA

Synonyms

LAT1, 2G5H3, 4F2 LC, 4F2 light chain, 4F2LC

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

67951-1-Ig targets SLC7A5 in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, goat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20291

  Product name: Recombinant human SLC7A5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 300-507 aa of BC039692

  Sequence: LSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQET

• Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 5
• Calculated Molecular Weight: 507 aa, 55 kDa
• Observed Molecular Weight: 35-50 kDa
• GenBank Accession Number: BC039692
• Gene Symbol: SLC7A5
• Gene ID (NCBI): 8140
• RRID: AB_2918703
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q01650
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Large neutral amino acid transporter 1 LAT1(also named as SLC7A5) is a sodium- and pH-independent transporter that supplies essential amino acids (e.g., leucine, phenylalanine) to cells. It plays an important role in the blood-brain barrier (BBB), where it facilitates the transport of thyroid hormones, drugs (e.g., l-DOPA, gabapentin), and metabolites to the brain. In addition, its expression is highly upregulated in various types of human cancers, which are characterized by a high demand for amino acids for growth and proliferation. The LAT1 subunit in humans is a 507 amino acid-long polypeptide with a theoretical molecular mass of 55 kDa. The protein is hydrophobic and is predicted to be constituted by 12 transmembrane segments. The apparent molecular mass of the proteins diminished to approximately 35 - 40 kDa.(PMID: 23912240 ;PMID: 26256001)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Metab; Extracellular acidosis restricts one-carbon metabolism and preserves T cell stemness; Authors - Hongcheng Cheng
		J Med Chem; Discovery of Novel Aminobutanoic Acid-Based ASCT2 Inhibitors for the Treatment of Non-Small-Cell Lung Cancer; Authors - Lian Qin
goat	IF	Anim Nutr; Long-term leucine supplementation increases body weight in goats by controlling appetite and muscle protein synthesis under protein-restricted conditions; Authors - Xiaokang Lv