SLC7A5 Recombinant monoclonal antibody, PBS Only

SLC7A5 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 84178-5-PBS
Clone No.241476D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

LAT1, 241476D5, 4F2 LC, 4F2 light chain, 4F2LC

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84178-5-PBS targets SLC7A5 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29164

Product name: Recombinant human SLC7A5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-58 aa of BC039692

Sequence: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAI

Predict reactive species
Full Name solute carrier family 7 (cationic amino acid transporter, y+ system), member 5
Calculated Molecular Weight 507 aa, 55 kDa
Observed Molecular Weight35-40 kDa
GenBank Accession NumberBC039692
Gene Symbol SLC7A5
Gene ID (NCBI) 8140
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ01650
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Large neutral amino acid transporter 1 LAT1(also named as SLC7A5) is a sodium- and pH-independent transporter that supplies essential amino acids (e.g., leucine, phenylalanine) to cells. It plays an important role in the blood-brain barrier (BBB), where it facilitates the transport of thyroid hormones, drugs (e.g., l-DOPA, gabapentin), and metabolites to the brain. In addition, its expression is highly upregulated in various types of human cancers, which are characterized by a high demand for amino acids for growth and proliferation. The LAT1 subunit in humans is a 507 amino acid-long polypeptide with a theoretical molecular mass of 55 kDa. The protein is hydrophobic and is predicted to be constituted by 12 transmembrane segments. The apparent molecular mass of the proteins diminished to approximately 35 - 40 kDa.(PMID: 23912240 ;PMID: 26256001)

Loading...
||
New chat Able
正在加载,请稍候...