Use Able AI chat for product recommendations

SLC7A5 Recombinant monoclonal antibody

SLC7A5 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 84178-5-RR
Clone No.241476D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

LAT1, 241476D5, 4F2 LC, 4F2 light chain, 4F2LC

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, MCF-7 cells, MKN-45 cells, SW480 cells
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHT-29 cells
Positive FC (Intra) detected inHT-29 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84178-5-RR targets SLC7A5 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29164

Product name: Recombinant human SLC7A5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-58 aa of BC039692

Sequence: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAI

Predict reactive species
Full Name solute carrier family 7 (cationic amino acid transporter, y+ system), member 5
Calculated Molecular Weight 507 aa, 55 kDa
Observed Molecular Weight35-40 kDa
GenBank Accession NumberBC039692
Gene Symbol SLC7A5
Gene ID (NCBI) 8140
RRIDAB_3671733
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ01650
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Large neutral amino acid transporter 1 LAT1(also named as SLC7A5) is a sodium- and pH-independent transporter that supplies essential amino acids (e.g., leucine, phenylalanine) to cells. It plays an important role in the blood-brain barrier (BBB), where it facilitates the transport of thyroid hormones, drugs (e.g., l-DOPA, gabapentin), and metabolites to the brain. In addition, its expression is highly upregulated in various types of human cancers, which are characterized by a high demand for amino acids for growth and proliferation. The LAT1 subunit in humans is a 507 amino acid-long polypeptide with a theoretical molecular mass of 55 kDa. The protein is hydrophobic and is predicted to be constituted by 12 transmembrane segments. The apparent molecular mass of the proteins diminished to approximately 35 - 40 kDa.(PMID: 23912240 ;PMID: 26256001)

Protocols

Product Specific Protocols
FC protocol for SLC7A5 antibody 84178-5-RRDownload protocol
IF protocol for SLC7A5 antibody 84178-5-RRDownload protocol
IHC protocol for SLC7A5 antibody 84178-5-RRDownload protocol
WB protocol for SLC7A5 antibody 84178-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...