Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated SLC7A5 Recombinant monoclonal antibody

SLC7A5 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-84178-5
Clone No.241476D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

LAT1, 241476D5, 4F2 LC, 4F2 light chain, 4F2LC

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHT-29 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84178-5 targets SLC7A5 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29164

Product name: Recombinant human SLC7A5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-58 aa of BC039692

Sequence: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAI

Predict reactive species
Full Name solute carrier family 7 (cationic amino acid transporter, y+ system), member 5
Calculated Molecular Weight 507 aa, 55 kDa
Observed Molecular Weight35-40 kDa
GenBank Accession NumberBC039692
Gene Symbol SLC7A5
Gene ID (NCBI) 8140
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ01650
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Large neutral amino acid transporter 1 LAT1(also named as SLC7A5) is a sodium- and pH-independent transporter that supplies essential amino acids (e.g., leucine, phenylalanine) to cells. It plays an important role in the blood-brain barrier (BBB), where it facilitates the transport of thyroid hormones, drugs (e.g., l-DOPA, gabapentin), and metabolites to the brain. In addition, its expression is highly upregulated in various types of human cancers, which are characterized by a high demand for amino acids for growth and proliferation. The LAT1 subunit in humans is a 507 amino acid-long polypeptide with a theoretical molecular mass of 55 kDa. The protein is hydrophobic and is predicted to be constituted by 12 transmembrane segments. The apparent molecular mass of the proteins diminished to approximately 35 - 40 kDa.(PMID: 23912240 ;PMID: 26256001)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SLC7A5 antibody CL488-84178-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...