CoraLite® Plus 488-conjugated SLC7A5 Recombinant monoclonal antibody

• 

  IF Staining of HT-29 using CL488-84178-5

  Immunofluorescent analysis of (4% PFA) fixed HT-29 cells using CoraLite® Plus 488 SLC7A5 antibody (CL488-84178-5, Clone: 241476D5 ) at dilution of 1:200.

SLC7A5 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84178-5

Clone No.241476D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

LAT1, 241476D5, 4F2 LC, 4F2 light chain, 4F2LC

---

Tested Applications

• Positive IF/ICC detected in: HT-29 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84178-5 targets SLC7A5 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29164

  Product name: Recombinant human SLC7A5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-58 aa of BC039692

  Sequence: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAI

• Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 5
• Calculated Molecular Weight: 507 aa, 55 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC039692
• Gene Symbol: SLC7A5
• Gene ID (NCBI): 8140
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q01650
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Large neutral amino acid transporter 1 LAT1(also named as SLC7A5) is a sodium- and pH-independent transporter that supplies essential amino acids (e.g., leucine, phenylalanine) to cells. It plays an important role in the blood-brain barrier (BBB), where it facilitates the transport of thyroid hormones, drugs (e.g., l-DOPA, gabapentin), and metabolites to the brain. In addition, its expression is highly upregulated in various types of human cancers, which are characterized by a high demand for amino acids for growth and proliferation. The LAT1 subunit in humans is a 507 amino acid-long polypeptide with a theoretical molecular mass of 55 kDa. The protein is hydrophobic and is predicted to be constituted by 12 transmembrane segments. The apparent molecular mass of the proteins diminished to approximately 35 - 40 kDa.(PMID: 23912240 ;PMID: 26256001)