SLC7A8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC7A8 Polyclonal antibody (30211-1-AP)

SLC7A8 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30211-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Solute carrier family 7 member 8, LAT2

• 

  WB analysis using 30211-1-AP

  JAR cells were subjected to SDS PAGE followed by western blot with 30211-1-AP (SLC7A8 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 30211-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30211-1-AP (SLC7A8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 30211-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using SLC7A8 antibody (30211-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC7A8 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human placenta tissue, JAR cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30211-1-AP targets SLC7A8 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32957

  Product name: Recombinant human SLC7A8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 468-535 aa of

  Sequence: YWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP

• Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 8
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 45-50 kDa
• Gene Symbol: SLC7A8
• Gene ID (NCBI): 23428
• RRID: AB_3086264
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHI5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Solute carrier family 7 member 8 (SLC7A8), also known as LAT2, is an amino acid transporter that, together with LAT1 (SLC7A5), facilitates the bidirectional transport of branched-chain and aromatic AAs across the plasma membrane.

Publications

What published studies show

The SLC7A8 Polyclonal antibody (Cat# 30211-1-AP) has 1 citation. It appears in Cell Reports in Medicine (IF: 14), published in 2026. The cited study investigates nanoparticle-based serine replenishment rescuing SP1-BNIP3 mitophagy and ameliorating preeclampsia in preclinical models, placing it in the fields of mitochondrial quality control, amino acid metabolism, and obstetric disease research. The application used was Western blot in human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep Med; Nanoparticle-based serine replenishment rescues SP1-BNIP3 mitophagy and ameliorates preeclampsia in preclinical models.; Authors - Yinan Wang