Able AI
What's the best dilution for NCX1 in ?
Product Information
85082-1-PBS targets NCX1 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag28952 Product name: Recombinant human SLC8A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of NM_021097 Sequence: MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGV Predict reactive species |
| Full Name | solute carrier family 8 (sodium/calcium exchanger), member 1 |
| Calculated Molecular Weight | 109 kDa |
| GenBank Accession Number | NM_021097 |
| Gene Symbol | NCX1 |
| Gene ID (NCBI) | 6546 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P32418 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
