SLC9A6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLC9A6 Polyclonal antibody (13877-1-AP)

SLC9A6 Polyclonal Antibody for WB, IP, ELISA

Cat No. 13877-1-AP Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

MRSA, NHE 6, NHE6, NHE-6

• 

  WB analysis using 13877-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13877-1-AP (SLC9A6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of rat brain using 13877-1-AP

  IP result of anti-SLC9A6 (IP:13877-1-AP, 4ug; Detection:13877-1-AP 1:600) with rat brain tissue lysate 1720 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 13877-1-AP

  IP result of anti-SLC9A6 (IP:13877-1-AP, 4ug; Detection:13877-1-AP 1:600) with mouse brain tissue lysate 1680 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC9A6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: unboiled mouse brain tissue, boiled mouse brain tissue
• Positive IP detected in: rat brain tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13877-1-AP targets SLC9A6 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4958

  Product name: Recombinant human SLC9A6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 500-701 aa of BC049169

  Sequence: RDTATYARQMMFSTTLLIVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPENERRTTKAESAWLFRMWYNFDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISLTYGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA

• Full Name: solute carrier family 9 (sodium/hydrogen exchanger), member 6
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 72-78 kDa
• GenBank Accession Number: BC049169
• Gene Symbol: SLC9A6
• Gene ID (NCBI): 10479
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92581
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The SLC9A6 gene, also known as NHE6 gene, is located on chromosome Xq26.3 and encodes a monovalent sodium-selective sodium/hydrogen exchanger (NHE) (PMID: 27142213). Loss-of-function mutations in endosomal Na+/H+ exchanger 6 (NHE6) encoded by SLC9A6 cause the X-linked neurologic disorder CS (PMID: 18342287). Slc9a6 loss of function causes the relevant defects, including disrupted endosomal-lysosomal function, neurodevelopmental and neurodegenerative pathology, impaired plasticity and impoverished neuronal arborization (PMID: 36621975). The SLC9A6 protein is mainly expressed in human brain tissues (PMID: 9039502). It is found in the membranes of intracellular organelles such as mitochondria and endosomes, playing an essential role in regulating endosomal pH and volume (PMID: 40722028).