SLC9A9 Monoclonal antibody, PBS Only

• 

  WB analysis using 66577-1-Ig (same clone as 66577-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66577-1-Ig (SLC9A9 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66577-1-Ig (same clone as 66577-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66577-1-Ig (SLC9A9 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66577-1-Ig (same clone as 66577-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66577-1-Ig (SLC9A9 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66577-1-Ig (same clone as 66577-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66577-1-Ig (SLC9A9 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66577-1-Ig (same clone as 66577-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66577-1-Ig (SLC9A9 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66577-1-Ig (same clone as 66577-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66577-1-Ig (SLC9A9 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66577-1-Ig (same clone as 66577-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66577-1-Ig (SLC9A9 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66577-1-Ig (same clone as 66577-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66577-1-Ig (SLC9A9 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66577-1-Ig (same clone as 66577-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66577-1-Ig (SLC9A9 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66577-1-Ig (same clone as 66577-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66577-1-Ig (SLC9A9 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66577-1-Ig (same clone as 66577-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66577-1-Ig (SLC9A9 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66577-1-Ig (same clone as 66577-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SLC9A9 antibody (66577-1-Ig, Clone: 1B8D9 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66577-1-PBS in a different storage buffer formulation.

SLC9A9 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66577-1-PBS

Clone No.1B8D9

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Na(+)/H(+) exchanger 9, Nbla00118, NHE 9, NHE9, SLC9A9, Sodium/hydrogen exchanger 9

---

Product Information

66577-1-PBS targets SLC9A9 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4660

  Product name: Recombinant human SLC9A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 481-645 aa of BC035779

  Sequence: TPMLTWLQIRVGVDLDENLKEDPSSQHQEANNLDKNMTKAESARLFRMWYSFDHKYLKPILTHSGPPLTTTLPEWCGPISRLLTSPQAYGEQLKEDDVECIVNQDELAINYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQTLGQSQLN

• Full Name: solute carrier family 9 (sodium/hydrogen exchanger), member 9
• Calculated Molecular Weight: 645 aa, 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC035779
• Gene Symbol: SLC9A9
• Gene ID (NCBI): 285195
• RRID: AB_2881937
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IVB4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.