PGT Polyclonal antibody

• 

  WB analysis using 14327-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14327-1-AP (PGT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 14327-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 14327-1-AP (PGT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 14327-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14327-1-AP (PGT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 14327-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14327-1-AP (PGT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 14327-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 14327-1-AP (PGT antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PGT Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14327-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

SLCO2A1, PHOAR2, OATP2A1

---

Tested Applications

• Positive WB detected in: mouse heart tissue, NIH/3T3 cells, mouse liver tissue, rat kidney tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 2 publications below

Product Information

14327-1-AP targets PGT in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5594

  Product name: Recombinant human PGT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 422-643 aa of BC041140

  Sequence: TPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPAIFLISFVSLIACISHNPLYMMVLRVVNQEEKSFAIGVQFLLMRLLAWLPSPALYGLTIDHSCIRWNSLCLGRRGACAYYDNDALRDRYLGLQMGYKALGMLLLCFISWRVKKNKEYNVQKAAGLI

• Full Name: solute carrier organic anion transporter family, member 2A1
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC041140
• Gene Symbol: PGT
• Gene ID (NCBI): 6578
• RRID: AB_2270464
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92959
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prostaglandin transporter (PGT), also known as SLCO2A1, has been identified as a functional prostaglandin (PG) carrier that mediates either the release of newly-synthesized PGs by cells and/or the uptake of PGs prior to intracellular oxidation. Northern blot analysis revealed that PGT mRNA has broad tissue distribution, suggesting its role in the transport and/ or metabolic clearance of PG in diverse tissues (8787677). This antibody is expected to detect the endogenous PGT protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	IHC	Biol Reprod; Prostaglandin Transporters ABCC4 and SLCO2A1 in the Uterine Endometrium and Conceptus During Pregnancy in Pigs.; Authors - Heewon Seo
mouse	WB	Int Immunopharmacol; Effect of oridonin on oxylipins in the livers of mice with acute liver injury induced by D-galactosamine and lipopolysaccharide.; Authors - Zhikun Zhan
human	IHC	Dig Dis Sci; Four Variants of SLCO2A1 Identified in Three Chinese Patients with Chronic Enteropathy Associated with the SLCO2A1 Gene.; Authors - Hui Huang