PGT Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PGT Polyclonal antibody (14327-1-AP)

PGT Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14327-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

SLCO2A1, OATP2A1, PHOAR2

• 

  WB analysis of NIH/3T3 using 14327-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 14327-1-AP (PGT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14327-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14327-1-AP (PGT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 14327-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14327-1-AP (PGT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 14327-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14327-1-AP (PGT antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 14327-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 14327-1-AP (PGT antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PGT in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, NIH/3T3 cells, mouse liver tissue, rat kidney tissue
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14327-1-AP targets PGT in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5594

  Product name: Recombinant human PGT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 422-643 aa of BC041140

  Sequence: TPTVAEVYPPSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAHFLLPAIFLISFVSLIACISHNPLYMMVLRVVNQEEKSFAIGVQFLLMRLLAWLPSPALYGLTIDHSCIRWNSLCLGRRGACAYYDNDALRDRYLGLQMGYKALGMLLLCFISWRVKKNKEYNVQKAAGLI

• Full Name: solute carrier organic anion transporter family, member 2A1
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC041140
• Gene Symbol: PGT
• Gene ID (NCBI): 6578
• RRID: AB_2270464
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92959
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Prostaglandin transporter (PGT), also known as SLCO2A1, has been identified as a functional prostaglandin (PG) carrier that mediates either the release of newly-synthesized PGs by cells and/or the uptake of PGs prior to intracellular oxidation. Northern blot analysis revealed that PGT mRNA has broad tissue distribution, suggesting its role in the transport and/ or metabolic clearance of PG in diverse tissues (8787677). This antibody is expected to detect the endogenous PGT protein.

Publications

What published studies show

The PGT Polyclonal antibody (Cat# 14327-1-AP) has 4 citations published in Int Immunopharmacol, J Hepatocell Carcinoma, Biol Reprod, and Dig Dis Sci. Research fields span hepatic oxylipin metabolism in acute liver injury, angiogenic prognostic signatures in hepatocellular carcinoma, prostaglandin transporter expression in porcine uterine endometrium during pregnancy, and SLCO2A1 variants in chronic enteropathy. Applications include WB and IHC across mouse, pig, and human species.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Int Immunopharmacol; Effect of oridonin on oxylipins in the livers of mice with acute liver injury induced by D-galactosamine and lipopolysaccharide.; Authors - Zhikun Zhan
		J Hepatocell Carcinoma; Angiogenic Prognostic Signature for Stratification in Hepatocellular Carcinoma.; Authors - Zhanwei Zhu
pig	IHC	Biol Reprod; Prostaglandin Transporters ABCC4 and SLCO2A1 in the Uterine Endometrium and Conceptus During Pregnancy in Pigs.; Authors - Heewon Seo
human	IHC	Dig Dis Sci; Four Variants of SLCO2A1 Identified in Three Chinese Patients with Chronic Enteropathy Associated with the SLCO2A1 Gene.; Authors - Hui Huang