SLIRP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SLIRP Polyclonal antibody, PBS Only (26006-1-PBS)

• 

  WB analysis using 26006-1-AP (same clone as 26006-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26006-1-AP (SLIRP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 26006-1-AP (same clone as 26006-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 26006-1-AP (SLIRP antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 26006-1-AP (same clone as 26006-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 26006-1-AP (SLIRP antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDA-MB-453s using 26006-1-AP (same clone as 26006-1-PBS)

  MDA-MB-453s cells were subjected to SDS PAGE followed by western blot with 26006-1-AP (SLIRP antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 26006-1-AP (same clone as 26006-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26006-1-AP (SLIRP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 26006-1-AP (same clone as 26006-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26006-1-AP (SLIRP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 26006-1-AP (same clone as 26006-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 26006-1-AP (SLIRP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 26006-1-AP (same clone as 26006-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 26006-1-AP (SLIRP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 26006-1-AP (same clone as 26006-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 26006-1-AP (SLIRP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 26006-1-AP (same clone as 26006-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26006-1-AP (SLIRP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 26006-1-AP (same clone as 26006-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using SLIRP antibody (26006-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 26006-1-AP (same clone as 26006-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using SLIRP antibody (26006-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26006-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLIRP Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 26006-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

C14orf156, DC23, DC50, PD04872, SRA stem-loop-interacting RNA-binding protein, mitochondrial

---

Product Information

26006-1-PBS targets SLIRP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22945

  Product name: Recombinant human C14orf156 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-109 aa of BC017895

  Sequence: MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF

• Full Name: chromosome 14 open reading frame 156
• Calculated Molecular Weight: 109 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC017895
• Gene Symbol: SLIRP
• Gene ID (NCBI): 81892
• RRID: AB_2880332
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZT3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLIRP, also named as C14orf156, DC23, DC50 and PD04872. It is an RNA-binding protein on steroid receptor RNA activator (SRA), and its expression is ubiquitous in human normal tissues. SLIRP can affect mitochondrial mRNA transcription and energy conversion. In addition, the loss or weakening of SLIRP destroys part of the structure of mitochondria, affects mitochondria energy metabolism, and increases sperm or cell oxidative stress damage (PMID: 33150185). SLIRP has 2 isoforms with the molecular mass of 12 kDa.