SLIT2 Polyclonal antibody

SLIT2 Polyclonal Antibody for WB, ELISA
Cat No. 28730-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Slit-2, Slit homolog 2 protein N-product, Slit homolog 2 protein C-product, Slit homolog 2 protein, Slit 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28730-1-AP targets SLIT2 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30428

Product name: Recombinant human SLIT2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1312-1482 aa of NM_004787

Sequence: YINSELQDFQKVPMQTGILPGCEPCHKKVCAHGTCQPSSQAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYTGDSCDREISCRGERIRDYYQKQQGYAACQTTKKVSRLEC

Predict reactive species
Full Name slit homolog 2 (Drosophila)
Calculated Molecular Weight 170 kDa
Observed Molecular Weight100 kDa, 200 kDa
GenBank Accession NumberNM_004787
Gene Symbol SLIT2
Gene ID (NCBI) 9353
RRIDAB_2935470
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO94813
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLIT2, also named as SLIL3, is thought to act as a molecular guidance cue in cellular migration, and function appears to be mediated by interaction with roundabout homolog receptors. During neural development is involved in axonal navigation at the ventral midline of the neural tube and projection of axons to different regions. SLIT1 and SLIT2 seem to be essential for midline guidance in the forebrain by acting as repulsive signal preventing inappropriate midline crossing by axons projecting from the olfactory bulb. In spinal chord development, SLIT2 may play a role in guiding commissural axons once they reached the floor plate by modulating the response to netrin. SLIT2 may be implicated in spinal chord midline post-crossing axon repulsion. In vitro, only commissural axons that crossed the midline responded to SLIT2. In the developing visual system it appears to function as repellent for retinal ganglion axons by providing a repulsion that directs these axons along their appropriate paths prior to, and after passage through, the optic chiasm. In vitro, it collapses and repels retinal ganglion cell growth cones. SLIT2 seems to play a role in branching and arborization of CNS sensory axons, and in neuronal cell migration. It seems to be involved in regulating leukocyte migration. The antibody is specific to SLIT2. Slit2 is cleaved into 140 kDa N-terminal (Slit2-N) and 55-60 kDa C-terminal (Slit2-C) fragments, although the uncleaved/full-length form(200) can also be detected.

Protocols

Product Specific Protocols
WB protocol for SLIT2 antibody 28730-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...