SLITRK4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SLITRK4 Polyclonal antibody (13835-1-AP)

SLITRK4 Polyclonal Antibody for WB, ELISA

Cat No. 13835-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

SLIT and NTRK like protein 4, SLIT and NTRK-like protein 4

• 

  WB analysis of mouse thymus using 13835-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 13835-1-AP (SLITRK4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLITRK4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13835-1-AP targets SLITRK4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4781

  Product name: Recombinant human SLITRK4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 33-355 aa of BC040986

  Sequence: VSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDL

• Full Name: SLIT and NTRK-like family, member 4
• Calculated Molecular Weight: 837 aa, 94 kDa
• Observed Molecular Weight: 96 kDa
• GenBank Accession Number: BC040986
• Gene Symbol: SLITRK4
• Gene ID (NCBI): 139065
• RRID: AB_2190333
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IW52
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SLITRK4 Polyclonal antibody (Cat# 13835-1-AP) has a total of 1 citation. The citation appears in Cell Oncology (2023), where the antibody was used for Western blot in human samples. The associated research field is gastric cancer liver metastasis, specifically investigating how the SLITRK4-CNPY3 axis enhances TrkB endocytosis and recycling in tumour cells to promote metastatic progression.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Oncol (Dordr); The SLITRK4-CNPY3 axis promotes liver metastasis of gastric cancer by enhancing the endocytosis and recycling of TrkB in tumour cells; Authors - Yao-Qi Zhou