SMAD1 Recombinant monoclonal antibody, PBS Only

SMAD1 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA, ChIP-qPCR
Cat No. 85388-1-PBS
Clone No.242844B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA, ChIP-qPCR

242844B4, BSP1, BSP-1, hSMAD1, JV41

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85388-1-PBS targets SMAD1 in WB, IHC, FC (Intra), Indirect ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0701

Product name: Recombinant human SMAD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 19-229 aa of BC001878

Sequence: GWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLP

Predict reactive species
Full Name SMAD family member 1
Calculated Molecular Weight 52 kDa
Observed Molecular Weight55 kDa
GenBank Accession NumberBC001878
Gene Symbol SMAD1
Gene ID (NCBI) 4086
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15797
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Transforming growth factor-β (TGF-β) superfamily is recognized as one of the largest families of secreted multifunctional peptides exerting different biological effects on a large variety of cell types, such as regulation of hormone secretion, stimulation of extracellular matrix formation, the inhibition of proliferation of many cell types, cell survival, bone formation, and chemotaxis for inflammatory cells. One of the most important proteins that modulate TGF-β ligand activity is the SMAD family proteins. SMAD1 is one of the receptor-activated Smads. It's also a signal transducers of BMP signaling and binds to several proteins involved in ubiquitin-proteasome system (UPS). Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase.

Loading...
||
New chat Able
正在加载,请稍候...