SMAD3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SMAD3 Polyclonal antibody (33480-1-AP)

SMAD3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33480-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

hMAD 3, hMAD-3, hSMAD3, HSPC193, HsT17436

• 

  WB analysis using 33480-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33480-1-AP (SMAD3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse prostate using 33480-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse prostate tissue slide using 33480-1-AP (SMAD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: U-87 MG cells
• Positive IHC detected in: mouse prostate tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33480-1-AP targets SMAD3 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8263

  Product name: Recombinant human SMAD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-141 aa of BC007496

  Sequence: MACTYVSNLGKKQRSVSFLASGLMRVSTGPELRLHHSFVLTGDVGRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQRSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG

• Full Name: SMAD family member 3
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC007496
• Gene Symbol: SMAD3
• Gene ID (NCBI): 4088
• RRID: AB_3742986
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P84022
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMAD3, also named as hMAD 3 or Mad3, is a 425 amino acid protein, which contains one MH1 domain and one MH2 domain. SMAD3 localizes in the nucleus and cytoplasm. SMAD3 plays an essential role in development and maintenance of self-tolerance and is a critical mediator of the TGFB signaling pathway. SMAD3 is involved in TGFB dependent regulation of steroidogenesis and in T-cell response to TGFB.