SMAD4 Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83169-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 83169-2-PBS against Human SMAD4 was performed. The affinity constant is 0.58 nM.

SMAD4 Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 83169-2-PBS

Clone No.240026D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

DPC4, hSMAD4, JIP, MAD homolog 4, MADH4

---

Product Information

83169-2-PBS targets SMAD4 in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0299

  Product name: Recombinant human SMAD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 13-227 aa of BC002379

  Sequence: NDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPAS

• Full Name: SMAD family member 4
• Calculated Molecular Weight: 60 kDa
• GenBank Accession Number: BC002379
• Gene Symbol: SMAD4
• Gene ID (NCBI): 4089
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13485
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.