SMAD7 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SMAD7 Recombinant monoclonal antibody, PBS Only (80964-5-PBS)

SMAD7 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 80964-5-PBS

Clone No.251688E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CRCS3, hSMAD7, MAD homolog 7, MAD homolog 8, MADH7

• 

  WB analysis using 80964-5-RR (same clone as 80964-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 80964-5-RR (SMAD7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80964-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human urothelial carcinoma using 80964-5-RR (same clone as 80964-5-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 80964-5-RR (SMAD7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80964-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 80964-5-RR (same clone as 80964-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 80964-5-RR (SMAD7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80964-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 80964-5-RR (same clone as 80964-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 80964-5-RR (SMAD7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80964-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

80964-5-PBS targets SMAD7 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13688

  Product name: Recombinant human SMAD7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-426 aa of BC074819

  Sequence: MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR

• Full Name: SMAD family member 7
• Calculated Molecular Weight: 426 aa, 46 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC074819
• Gene Symbol: SMAD7
• Gene ID (NCBI): 4092
• RRID: AB_3743361
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15105
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMAD7, also named as Mothers against decapentaplegic homolog 7, is a 426 amino acid protein, which belongs to the dwarfin/SMAD family. SMAD7 Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm (PubMed:16601693). TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucleus to the cytoplasm in response to TGF-beta (PubMed:17327236). SMAD7 as antagonist of signaling by TGF-beta type 1 receptor superfamily members has been shown to inhibit TGF-beta and activin signaling by associating with their receptors thus preventing SMAD2 access. SMAD7 functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex and also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. SMAD7 positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.