SMAP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SMAP2 Polyclonal antibody (16597-1-AP)

SMAP2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16597-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

small ArfGAP2, SMAP1L, Stromal membrane-associated protein 1-like, Stromal membrane-associated protein 2

• 

  WB analysis of human liver using 16597-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16597-1-AP (SMAP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 16597-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16597-1-AP (SMAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse small intestine using 16597-1-AP

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 16597-1-AP (SMAP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human colon using 16597-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 16597-1-AP (SMAP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16597-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16597-1-AP (SMAP2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16597-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16597-1-AP (SMAP2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 16597-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16597-1-AP (SMAP2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 16597-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using SMAP2 antibody (16597-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SMAP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human liver tissue, human colon tissue, K-562 cells, mouse small intestine tissue, LNCaP cells, PC-3 cells
• Positive IHC detected in: human liver tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16597-1-AP targets SMAP2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9751

  Product name: Recombinant human SMAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 77-429 aa of BC021133

  Sequence: QIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKSTAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSFPGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQAGYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAANQTLSPQMWK

• Full Name: small ArfGAP2
• Calculated Molecular Weight: 429 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC021133
• Gene Symbol: SMAP2
• Gene ID (NCBI): 64744
• RRID: AB_2066026
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WU79
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The SMAP2 polyclonal antibody (Cat# 16597-1-AP) has 1 citation to date. It was cited in Ecotoxicology and Environmental Safety (IF 6.6) in a 2026 study by Chuan Wang et al., which investigated how PFOA exposure impairs sperm head shaping in mice, leading to decreased acrosome reaction and increased DNA oxidative damage. The research falls within the fields of environmental toxicology and reproductive biology. The antibody was used for Western blot analysis in mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Ecotoxicol Environ Saf; PFOA exposure decreases acrosome reaction and increases DNA oxidative damage by impairing the sperm head shaping in mice.; Authors - Chuan Wang