SMC2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SMC2 Polyclonal antibody, PBS Only (30707-1-PBS)

• 

  WB analysis using 30707-1-AP (same clone as 30707-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30707-1-AP (SMC2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30707-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 30707-1-AP (same clone as 30707-1-PBS)

  WB result of SMC2 antibody (30707-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SMC2 transfected HeLa cells. This data was developed using the same antibody clone with 30707-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 30707-1-AP (same clone as 30707-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 30707-1-AP (SMC2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30707-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 30707-1-AP (same clone as 30707-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 30707-1-AP (SMC2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30707-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30707-1-AP (same clone as 30707-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SMC2 antibody (30707-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 30707-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SMC2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30707-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CAP E, CAPE, hCAP E, SMC 2, SMC protein 2

---

Product Information

30707-1-PBS targets SMC2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33471

  Product name: Recombinant human SMC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1000-1197 aa of NM_001042550.1

  Sequence: DLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPPKGAHVEV

• Full Name: structural maintenance of chromosomes 2
• Calculated Molecular Weight: 136 kDa
• Observed Molecular Weight: 135 kDa
• GenBank Accession Number: NM_001042550.1
• Gene Symbol: SMC2
• Gene ID (NCBI): 10592
• RRID: AB_3086394
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95347
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SMC2 is a central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases (PMID: 11136719).