SMCR7L Monoclonal antibody, PBS Only

• 

  WB analysis using 67808-1-Ig (same clone as 67808-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67808-1-Ig (SMCR7L/MID51 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67808-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67808-1-Ig (same clone as 67808-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67808-1-Ig (SMCR7L/MID51 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67808-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 67808-1-Ig (same clone as 67808-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67808-1-Ig (SMCR7L/MID51 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67808-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 67808-1-Ig (same clone as 67808-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using SMCR7L/MID51 antibody (67808-1-Ig, Clone: 3B3G3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67808-1-PBS in a different storage buffer formulation.

SMCR7L Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 67808-1-PBS

Clone No.3B3G3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse , rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

dJ1104E15.3, FLJ20232, HSU79252, MID51, MIEF1, SMCR7L

---

Product Information

67808-1-PBS targets SMCR7L in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, mouse , rat samples.

• Tested Reactivity: Human, mouse , rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13775

  Product name: Recombinant human SMCR7L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-359 aa of BC002587

  Sequence: FDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT

• Full Name: Smith-Magenis syndrome chromosome region, candidate 7-like
• Calculated Molecular Weight: 463 aa, 51 kDa
• Observed Molecular Weight: 48-51 kDa
• GenBank Accession Number: BC002587
• Gene Symbol: SMCR7L
• Gene ID (NCBI): 54471
• RRID: AB_2918571
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NQG6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human SMCR7L gene encodes, MID51, the mitochondrial dynamic protein of 51 kDa (also called mitochondrial elongation factor 1, MIEF1). MID51 is a single-pass membrane protein anchored to the mitochondrial outer membrane and regulates mitochondrial morphology. Mitochondrial morphology is controlled by two opposing processes: fusion and fission. Elevated MID51 levels induce extensive mitochondrial fusion, whereas depletion of MID51 causes mitochondrial fragmentation. MID51 interacts with and recruits Drp1 to mitochondria, suggesting a critical role of MID51 in regulation of mitochondrial fusion-fission machinery in vertebrates.