Filter: AllIHC

IHC staining of human colon cancer using 30036-1-AP (same clone as 30036-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 30036-1-AP (LOC284422 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30036-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 30036-1-AP (same clone as 30036-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 30036-1-AP (LOC284422 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30036-1-PBS in a different storage buffer formulation.

SMIM24 Polyclonal antibody, PBS Only

Name: SMIM24 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 30036-1-PBS

SMIM24 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 30036-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

30036-1-PBS targets SMIM24 in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag32464 Product name: Recombinant human LOC284422 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-130 aa of BC146984 Sequence: QQATEHRLKPWLVGLAAVVGFLFIVYLVLLANRLWCSKARAEDEEETTFRMESNLYQDQSEDKREKKEAKEKEEKRKKEKKTAKEGESNLGLDLEEKEPGDHERAKSTVM Predict reactive species
Full Name	similar to HSPC323
GenBank Accession Number	BC146984
Gene Symbol	LOC284422
Gene ID (NCBI)	284422
RRID	AB_3669701
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75264
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

SMIM24 (small integral membrane protein 24) is located in the membrane and may be an integral component of the membrane.

Able™