• Featured Product
  • KD/KO Validated

SMN (Human,Mouse,Rat) Monoclonal antibody

SMN (Human,Mouse,Rat) Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 60154-2-Ig
Clone No.3C10B5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

SMN, 3C10B5, C BCD541, Component of gems 1, Gemin 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, A375 cells, HeLa cells, T-47D cells, HEK-293 cells, MOLT-4 cells, Jurkat cells, Raji cells
Positive IHC detected inhuman rectal cancer tissue, human colon cancer, mouse brain tissue, mouse kidney tissue, mouse liver tissue, rat kidney tissue, rat liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60154-2-Ig targets SMN (Human,Mouse,Rat) in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14333

Product name: Recombinant human SMN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-282 aa of BC000908

Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA

Predict reactive species
Full Name survival of motor neuron 2, centromeric
Calculated Molecular Weight 282 aa, 30 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC000908
Gene Symbol SMN
Gene ID (NCBI) 6607
RRIDAB_10792407
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16637
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The survival of motor neurons (SMN) genes are the disease genes of spinal muscular atrophy (SMA), a common motor neuron degenerative disease. The level of SMN protein correlates with phenotypic severity of SMA. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional, because a large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein. This antibody 60154-2-Ig can recognize human,mouse and rat SMN gene.

Protocols

Product Specific Protocols
FC protocol for SMN (Human,Mouse,Rat) antibody 60154-2-IgDownload protocol
IF protocol for SMN (Human,Mouse,Rat) antibody 60154-2-IgDownload protocol
IHC protocol for SMN (Human,Mouse,Rat) antibody 60154-2-IgDownload protocol
WB protocol for SMN (Human,Mouse,Rat) antibody 60154-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...