• Featured Product
  • KD/KO Validated

SMN (Human,Mouse,Rat) Monoclonal antibody, PBS Only

SMN (Human,Mouse,Rat) Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 60154-2-PBS
Clone No.3C10B5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

SMN, 3C10B5, C BCD541, Component of gems 1, Gemin 1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60154-2-PBS targets SMN (Human,Mouse,Rat) in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14333

Product name: Recombinant human SMN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-282 aa of BC000908

Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA

Predict reactive species
Full Name survival of motor neuron 2, centromeric
Calculated Molecular Weight 282 aa, 30 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC000908
Gene Symbol SMN
Gene ID (NCBI) 6607
RRIDAB_10792407
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16637
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The survival of motor neurons (SMN) genes are the disease genes of spinal muscular atrophy (SMA), a common motor neuron degenerative disease. The level of SMN protein correlates with phenotypic severity of SMA. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional, because a large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein. This antibody 60154-2-Ig can recognize human,mouse and rat SMN gene.

Loading...
||
New chat Able
正在加载,请稍候...