• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated SMN (Human,Mouse,Rat) Monoclonal antibody

SMN (Human,Mouse,Rat) Monoclonal Antibody for IF/ICC

Cat No. CL594-60154
Clone No.3C10B5

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

IF/ICC

C BCD541, Component of gems 1, FLJ76644, Gemin 1, SMN, SMN (Human,Mouse,Rat), SMN1, SMN1,SMN, SMN2, SMNC, SMNT, Survival motor neuron protein

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60154 targets SMN (Human,Mouse,Rat) in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14333

Product name: Recombinant human SMN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-282 aa of BC000908

Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA

Predict reactive species
Full Name survival of motor neuron 2, centromeric
Calculated Molecular Weight 282 aa, 30 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC000908
Gene Symbol SMN
Gene ID (NCBI) 6607
RRIDAB_2883429
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16637
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The survival of motor neurons (SMN) genes are the disease genes of spinal muscular atrophy (SMA), a common motor neuron degenerative disease. The level of SMN protein correlates with phenotypic severity of SMA. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional, because a large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein. This antibody 60154-2-Ig can recognize human,mouse and rat SMN gene.

Protocols

Product Specific Protocols
IF protocol for CL594 SMN (Human,Mouse,Rat) antibody CL594-60154Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...