SMPX Polyclonal antibody

SMPX Polyclonal Antibody for WB, IHC, ELISA
Cat No. 15791-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, pig

Applications

WB, IHC, ELISA

small muscle protein, X linked, Small muscular protein, SMPX, SRMX

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig skeletal muscle tissue, human skeletal muscle tissue, human colon tissue, pig colon tissue
Positive IHC detected inhuman kidney tissue, human brain tissue, human lung tissue, human ovary tissue, human spleen tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15791-1-AP targets SMPX in WB, IHC, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8497

Product name: Recombinant human SMPX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-88 aa of BC005948

Sequence: MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Predict reactive species
Full Name small muscle protein, X-linked
Calculated Molecular Weight 88 aa, 10 kDa
Observed Molecular Weight 9 kDa
GenBank Accession NumberBC005948
Gene Symbol SMPX
Gene ID (NCBI) 23676
RRIDAB_2193527
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UHP9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for SMPX antibody 15791-1-APDownload protocol
WB protocol for SMPX antibody 15791-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...