SMU1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SMU1 Polyclonal antibody (33253-1-AP)

• 

  WB analysis using 33253-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33253-1-AP (SMU1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

SMU1 Polyclonal Antibody for WB, ELISA

Cat No. 33253-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

BWD, fSAP57, SAP57, SMU 1, Smu-1 suppressor of mec-8 and unc-52 protein homolog

---

Tested Applications

• Positive WB detected in: mouse lung tissue, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33253-1-AP targets SMU1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29580

  Product name: Recombinant human SMU1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 185-365 aa of BC002876

  Sequence: DLFRGKAAVKDVEEEKFPTQLSRHIKFGQKSHVECARFSPDGQYLVTGSVDGFIEVWNFTTGKIRKDLKYQAQDNFMMMDDAVLCMCFSRDTEMLATGAQDGKIKVWKIQSGQCLRRFERAHSKGVTCLSFSKDSSQILSASFDQTIRIHGLKSGKTLKEFRGHSSFVNEATFTQDGHYII

• Full Name: smu-1 suppressor of mec-8 and unc-52 homolog (C. elegans)
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC002876
• Gene Symbol: SMU1
• Gene ID (NCBI): 55234
• RRID: AB_3742915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q2TAY7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The SMU1 gene, situated on human chromosome 9p21.1, is highly conserved across eukaryotic species and encodes a protein with a WD40 domain, placing it within the WD40-repeat protein family. SMU1 is involved in various cellular processes such as signal transduction, pre-mRNA processing, and cytoskeleton assembly modulation through its receptor/regulator module.