SMURF2 Polyclonal antibody

• 

  WB analysis using 18038-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18038-1-AP (SMURF2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18038-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18038-1-AP (SMURF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 18038-1-AP

  IP result of anti-SMURF2 (IP:18038-1-AP, 4ug; Detection:18038-1-AP 1:300) with mouse testis tissue lysate 4000 ug.

• 

  IHC staining of human lung cancer using 18038-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human malignant melanoma using 18038-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 18038-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 18038-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat testis using 18038-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat testis using 18038-1-AP

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 18038-1-AP (SMURF2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

SMURF2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18038-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

hSMURF2, SMURF2

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: human lung cancer tissue, human malignant melanoma tissue, mouse testis tissue, rat kidney tissue, rat testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below
• IP: See 1 publications below

Product Information

18038-1-AP targets SMURF2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12666

  Product name: Recombinant human SMURF2 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 390-748 aa of BC093876

  Sequence: AGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE

• Full Name: SMAD specific E3 ubiquitin protein ligase 2
• Calculated Molecular Weight: 748 aa, 86 kDa
• Observed Molecular Weight: 86-100 kDa
• GenBank Accession Number: BC093876
• Gene Symbol: SMURF2
• Gene ID (NCBI): 64750
• RRID: AB_3085549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HAU4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs,TGF-beta receptor,and other substrates.It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression(PMID:22231558).SMURF2 associates constitutively with SMAD7 and it is nuclear, but binding to SMAD7 induces export and recruitment to activated TGFBR, where it causes degradation of receptors and of SMAD7 via proteasomal and lysosomal pathways(PMIF:11163210). SMURF2 can be detected 100 kDa by poly-sumoylated (PMID:26679521).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; SMURF2 predisposes cancer cell toward ferroptosis in GPX4-independent manners by promoting GSTP1 degradation; Authors - Wenxin Zhang ; KD Validated
mouse	IP	Mol Med; Acid ceramidase targeting pyruvate kinase affected trypsinogen activation in acute pancreatitis; Authors - Juan Xiao
	WB	Korean Circ J; UPF1 Alleviates Myocardial Ischemia-Reperfusion Injury by Regulating SMURF2-Mediated Ubiquitination Degradation of FOXA2; Authors - Aixin Li
mouse	WB	Cancer Lett; UBE2C promotes pancreatic tumorigenesis by KRAS stabilization via APC/CCDH1-mediated WDR76 degradation; Authors - Linchen Wang
rat	WB	Front Immunol; FOXA2/miR-148a-3p/SMURF2 signaling feed-forward loop alleviates spinal cord ischemia-reperfusion injury-induced neuropathic pain by modulating microglia polarization in rats; Authors - Xiaotong Hao ; KD Validated