Use Able AI chat for product recommendations

SNAI1 Recombinant monoclonal antibody, PBS Only (Capture)

SNAI1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 81584-4-PBS
Clone No.240164C2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

240164C2, SLUGH 2, SLUGH2, SNAI 1, SNAIL1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81584-4-PBS targets SNAI1 as part of a matched antibody pair:

MP00343-2: 81584-4-PBS capture and 81584-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24248

Product name: Recombinant human SNAI1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 22-164 aa of BC012910

Sequence: LQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYL

Predict reactive species
Full Name snail homolog 1 (Drosophila)
Calculated Molecular Weight 264 aa, 29 kDa
GenBank Accession NumberBC012910
Gene Symbol SNAI1
Gene ID (NCBI) 6615
RRIDAB_3670499
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95863
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SNAI1, a member of SNAI1 family of protein, participates in the epithelial to mesenchymal transition(EMT) and formation and maintenance of embryonic mesoderm. The snail family share a common structural, that a highly conserved C-terminal region containing a zinc finger transcription factor. SNAI1 interacts with other corepressor, such as Ajuba, PRMT5 and SIN3a or HDAC1 and 2, to repress the target gene. As the phosphorylation modification of SNAI1 protein, the range of molecular weight of SNAI1 is about 25-30 kDa (PMID: 22276203 ). Once phosphorylated (probably on Ser-107, Ser-111, Ser-115 and Ser-119) it is exported from the nucleus to the cytoplasm where subsequent phosphorylation of the destruction motif and ubiquitination involving BTRC occurs.

Loading...
||
New chat

Able

正在加载,请稍候...