SNAI1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP00343-2

  The mean SNAI1 concentration was determined to be 3,819.6 pg/mL in HCT116 cell extract based on a 3.0 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP00343-2

  Sandwich ELISA standard curve of MP00343-2, Human SNAI1 Recombinant Matched Antibody Pair - PBS only. 81584-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag24248. 81584-3-PBS was HRP conjugated as the detection antibody. Range: 31.25-1000 pg/mL.

• 

  IF Staining of HeLa using 81584-4-RR (same clone as 81584-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using SNAI1 antibody (81584-4-RR, Clone: 240164C2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 81584-4-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 81584-4-RR (same clone as 81584-4-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug SNAI1 Recombinant antibody (81584-4-RR, Clone:240164C2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 81584-4-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00343-2

  Cytometric bead array standard curve of MP00343-2, SNAI1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 81584-4-PBS. Detection antibody: 81584-3-PBS. Standard: Ag24248. Range: 0.625-20 ng/mL.

• 

  Affinity and Kinetic Characterization of 81584-4-RR

  Biolayer interferometry (BLl) kinetic assays of 81584-4-RR against Human SNAI1 were performed. The affinity constant is below 1 pM.

SNAI1 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 81584-4-PBS

Clone No.240164C2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

240164C2, SLUGH 2, SLUGH2, SNAI 1, SNAIL1

---

Product Information

81584-4-PBS targets SNAI1 as part of a matched antibody pair:

MP00343-2: 81584-4-PBS capture and 81584-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24248

  Product name: Recombinant human SNAI1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 22-164 aa of BC012910

  Sequence: LQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYL

• Full Name: snail homolog 1 (Drosophila)
• Calculated Molecular Weight: 264 aa, 29 kDa
• GenBank Accession Number: BC012910
• Gene Symbol: SNAI1
• Gene ID (NCBI): 6615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95863
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SNAI1, a member of SNAI1 family of protein, participates in the epithelial to mesenchymal transition(EMT) and formation and maintenance of embryonic mesoderm. The snail family share a common structural, that a highly conserved C-terminal region containing a zinc finger transcription factor. SNAI1 interacts with other corepressor, such as Ajuba, PRMT5 and SIN3a or HDAC1 and 2, to repress the target gene. As the phosphorylation modification of SNAI1 protein, the range of molecular weight of SNAI1 is about 25-30 kDa (PMID: 22276203 ). Once phosphorylated (probably on Ser-107, Ser-111, Ser-115 and Ser-119) it is exported from the nucleus to the cytoplasm where subsequent phosphorylation of the destruction motif and ubiquitination involving BTRC occurs.