SNAI1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 81584-5-RR (same clone as 81584-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 81584-5-RR (SNAI1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81584-5-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 81584-5-RR (same clone as 81584-5-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug SNAI1 Recombinant antibody (81584-5-RR, Clone:240164C11) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 81584-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 81584-5-RR

  Biolayer interferometry (BLl) kinetic assays of 81584-5-RR against Human SNAI1 were performed. The affinity constant is 0.64 nM.

SNAI1 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 81584-5-PBS

Clone No.240164C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

Zinc finger protein SNAI1, SNAIL1, SNAI 1, SLUGH2, SLUGH 2

---

Product Information

81584-5-PBS targets SNAI1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24248

  Product name: Recombinant human SNAI1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 22-164 aa of BC012910

  Sequence: LQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYL

• Full Name: snail homolog 1 (Drosophila)
• Calculated Molecular Weight: 264 aa, 29 kDa
• GenBank Accession Number: BC012910
• Gene Symbol: SNAI1
• Gene ID (NCBI): 6615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O95863
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.