SNAI1 Recombinant monoclonal antibody, PBS Only

SNAI1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 82214-2-PBS
Clone No.230035C9

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, Indirect ELISA

dJ710H13.1, Protein sna, Protein snail homolog 1, SLUGH2, SNA, SNAH, SNAI1, snail homolog 1 (Drosophila), SNAIL1, Zinc finger protein SNAI1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82214-2-PBS targets SNAI1 in WB, Indirect ELISA applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3723

Product name: Recombinant human SNAI1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-264 aa of BC012910

Sequence: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR

Predict reactive species
Full Name snail homolog 1 (Drosophila)
Calculated Molecular Weight 264 aa, 29 kDa
Observed Molecular Weight35 kDa
GenBank Accession NumberBC012910
Gene Symbol SNAI1
Gene ID (NCBI) 6615
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95863
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SNAI1, a member of SNAI1 family of protein, participates in the epithelial to mesenchymal transition(EMT) and formation and maintenance of embryonic mesoderm. The snail family share a common structural, that a highly conserved C-terminal region containing a zinc finger transcription factor. SNAI1 interacts with other corepressor, such as Ajuba, PRMT5 and SIN3a or HDAC1 and 2, to repress the target gene. As the phosphorylation modification of SNAI1 protein, the range of molecular weight of SNAI1 is about 25-30 kDa (PMID: 22276203 ). Once phosphorylated (probably on Ser-107, Ser-111, Ser-115 and Ser-119) it is exported from the nucleus to the cytoplasm where subsequent phosphorylation of the destruction motif and ubiquitination involving BTRC occurs.

Loading...
||
New chat Able
正在加载,请稍候...